Domains starting with letter W

List of .net domains starting with letter W

from w3des.net to wacow.net


Tools: Traceroute 209.188.81.132 - Ping 209.188.81.132 - More domains on 209.188.81.132 - Domains on IP address class 209.188.81.*
No. Domain name IP Registration date
101 w3des.net 62.146.91.122
102 w3director.net 74.53.161.130
103 w3discountmall.stores.yahoo.net 68.142.205.137
104 w3ip.net 222.231.47.146
105 w3lab.net 209.204.254.93
106 w3links.net 68.178.254.22
107 w3m.sourceforge.net 216.34.181.96
108 w3master.net 212.72.183.155
109 w3media.net 192.197.101.208
110 w3name.net 124.40.3.171
111 w3nodi.net 84.144.194.195
112 w3park.net 87.106.11.160
113 w3pla.net 217.116.47.158
114 w3range.net 65.254.254.34
115 w3sidan.net 213.114.105.201
116 w3stat.net 69.64.155.133
117 w3studio.net 75.125.153.82
118 w3systems.net 212.67.202.182
119 w3tool.net 202.222.30.195
120 w3u.net 209.126.136.122
121 w4cms.net 81.0.240.212
122 w4h.net 69.41.162.41
123 w4kgu.net 65.98.16.114
124 w4links.net 82.103.131.54
125 w4tch0.net 66.246.235.42
126 w4w.net 87.225.242.2
127 w555.net 118.102.24.109
124.42.35.181
128 w5d.net 82.165.59.189
129 w5jh.net 74.208.29.62
130 w666w.net 69.4.238.104
131 w66w.net 208.43.99.232
132 w6e.net 205.177.28.73
133 w6q.net 205.177.28.74
134 w6w.net 67.228.201.72
135 w8.net 216.104.145.231
136 w8sms.net 87.229.24.210
26 Nov, 2008
137 w8u.net 67.225.156.75
138 w8zr.net 134.53.7.196
139 w91.net 203.171.238.254
140 w95.net 216.105.89.29
141 w9og.net 64.29.145.9
142 wa-ha-ha.net 202.191.114.88
143 wa-k12.net 152.157.6.4
144 wa-ka.net 219.163.200.92
145 wa-mx.net 216.65.20.133
146 wa-realestate.net 64.22.233.131
147 wa-sar.net 131.191.19.161
148 wa-shoku.net 64.56.177.10
149 wa-studio.net 213.186.33.87
150 wa-us.net 67.183.128.150
151 wa1.net 82.98.86.179
152 wa18.net 97.74.8.248
153 wa3d.net 82.98.86.169
154 wa4dsy.net 208.65.91.26
155 wa6an.net 208.43.123.226
156 wa6uvv.net 209.202.252.41
157 wa7aa.net 216.36.49.209
158 wa8.net 112.84.254.233
25 Oct, 2007
159 wa8pyr.net 64.23.63.225
160 wa9sei.net 209.160.40.171
161 waaam.net 72.249.30.211
4 Iun, 2000
162 waaf.net 83.136.85.111
163 waagemut.net 81.169.145.67
164 waagen4you.net 80.242.134.222
165 waardeel.net 195.35.183.47
166 waargaanwestappen.net 216.188.26.235
216.188.26.237
167 waasland.net 212.123.6.44
168 waayaha.net 195.47.247.104
169 waba.sourceforge.net 216.34.181.96
170 wabanaki.net 65.99.1.131
171 wabashinn.net 68.178.211.122
172 wabavenue.net 194.85.91.233
173 wabbs.net 222.76.216.44
174 wabisuke.net 59.106.29.11
175 wabisurf.net 66.116.109.20
176 wablog.net 210.171.130.188
177 wabnig.net 85.13.133.237
178 wabr.net 208.67.85.28
179 wacam.net 87.98.193.132
180 wacan.net 82.97.9.44
181 wacca.net 60.32.200.70
182 waccamawfamilypractice.familydoctors.net 208.74.44.15
183 wachauer.net 78.142.132.242
184 wachi.net 210.188.201.190
9 Oct, 2008
185 wachta.net 85.128.204.198
186 wachuma.net 212.187.205.228
187 wacinfo.net 222.240.205.112
188 wackeldackel.net 89.107.184.39
189 wackelnasen.net 85.13.135.61
190 wackerweb.net 82.165.109.193
191 wackmymeat.net 69.64.155.121
192 wackoproductions.net 208.113.221.167
193 wacky-packages.net 64.202.189.109
194 wackyfish.net 66.226.64.6
195 wackyfun.net 64.202.189.170
196 wackytoons.net 81.4.88.46
197 wacofreightliner.net 66.76.103.38
198 wacom-shop.net 77.220.239.38
199 wacomshop.net 89.200.169.174
200 wacow.net 209.188.81.132